www.cyberscan.io uses cookies
We use cookies to give you the best possible use of our website. You can find out more in our data privacy policy or imprint. By clicking on "Allow all", you consent to the use of these technologies. You can revoke your consent here at any time with effect for the future.
Cookie description:
Required (2)
Preferences (0)
Statistic (3)
Marketing (0)
Required cookies help make a website usable by enabling basic functions such as page navigation and access to secure areas of the website. The website cannot function properly without these cookies.
Name Provider Reason Expiration Type
csid Cyberscan Saves user session data.

1 year HTTP
cs-cookie Cyberscan Saves the consent status of the user for cookies on the current domain.

1 year HTTP
Preference cookies enable a website to remember information that changes the way the website behaves or looks, like your preferred language or the region that you are in.
Name Provider Reason Expiration Type
- We do not use cookies of this type. - - -


Statistics cookies help website owners understand how visitors interact with websites by collecting and reporting information anonymously.
Name Provider Reason Expiration Type
_ga Google Tag Registers a unique ID that is used to generate statistical data on how the visitor uses the website. 2 years HTTP
_gat Google Tag Used by Google Analytics to throttle request rate

1 year HTTP
_gid Google Tag Registers a unique ID that is used to generate statistical data on how the visitor uses the website. 1 year HTTP
Marketing cookies are used to track visitors across websites. The intention is to display ads that are relevant and engaging for the individual user and thereby more valuable for publishers and third party advertisers.
Name Provider Reason Expiration Type
- We do not use cookies of this type. - - -


cyberscan.io   
Toggle navigation
    • Language
      • deGerman
      • enEnglish
  •   Demo User2

    • Demo User2 demouser@dgc.org

    • Login
      Register
  • MAIN NAVIGATION
  • Active Domains
    • Overview
    • weihnachtsmannberlin.de weihnachtsmannberli...
    • weihnachtsmanndorf.de weihnachtsmanndorf....
    • weihnachtsmannfreie-zone.de weihnachtsmannfreie...
    • weihnachtsmannservice-hessen.de weihnachtsmannservi...
    • weihnachtsmannspiel.de weihnachtsmannspiel...
    • weihnachtsmarkt-achenmuehle.de weihnachtsmarkt-ach...
    • weihnachtsmarkt-altsachsenhausen.de weihnachtsmarkt-alt...
    • weihnachtsmarkt-am-rudolfplatz.de weihnachtsmarkt-am-...
    • weihnachtsmarkt-amberg.de weihnachtsmarkt-amb...
    • weihnachtsmarkt-ansbach.de weihnachtsmarkt-ans...
    • weihnachtsmarkt-aschaffenburg.de weihnachtsmarkt-asc...
    • weihnachtsmarkt-aschendorf.de weihnachtsmarkt-asc...
    • weihnachtsmarkt-bad-griesbach.de weihnachtsmarkt-bad...
    • weihnachtsmarkt-badems.de weihnachtsmarkt-bad...
    • weihnachtsmarkt-badsassendorf.de weihnachtsmarkt-bad...
    • weihnachtsmarkt-badwimpfen.de weihnachtsmarkt-bad...
    • weihnachtsmarkt-berlin.de weihnachtsmarkt-ber...
    • weihnachtsmarkt-bernau.de weihnachtsmarkt-ber...
    • weihnachtsmarkt-bernkastel-kues.de weihnachtsmarkt-ber...
    • weihnachtsmarkt-bielefeld.de weihnachtsmarkt-bie...
    • weihnachtsmarkt-birkenheide.de weihnachtsmarkt-bir...
    • weihnachtsmarkt-borghees.de weihnachtsmarkt-bor...
    • weihnachtsmarkt-borken.de weihnachtsmarkt-bor...
    • weihnachtsmarkt-burscheid.de weihnachtsmarkt-bur...
    • weihnachtsmarkt-celle.de weihnachtsmarkt-cel...
    • weihnachtsmarkt-coesfeld.de weihnachtsmarkt-coe...
    • weihnachtsmarkt-colditz.de weihnachtsmarkt-col...
    • weihnachtsmarkt-der-nationen.de weihnachtsmarkt-der...
    • weihnachtsmarkt-dinkelsbuehl.de weihnachtsmarkt-din...
    • weihnachtsmarkt-drebber.de weihnachtsmarkt-dre...
    • weihnachtsmarkt-dre...
      • Dashboard
      • IPs
      • IPs Vulnerabilities
      • Vhosts
      • Vhosts Vulnerabilities
      • Darknet
      • Networks
      • Organizations
      • ISPs
      • Worldmap
    • weihnachtsmarkt-dresden.de weihnachtsmarkt-dre...
    • weihnachtsmarkt-duesseldorf.de weihnachtsmarkt-due...
    • weihnachtsmarkt-ebermannsdorf.de weihnachtsmarkt-ebe...
    • weihnachtsmarkt-eisenstein.de weihnachtsmarkt-eis...
    • weihnachtsmarkt-ende.de weihnachtsmarkt-end...
    • weihnachtsmarkt-finder.de weihnachtsmarkt-fin...
    • weihnachtsmarkt-freiburg.de weihnachtsmarkt-fre...
    • weihnachtsmarkt-gau-algesheim.de weihnachtsmarkt-gau...
    • weihnachtsmarkt-gemen.de weihnachtsmarkt-gem...
    • weihnachtsmarkt-gotha.de weihnachtsmarkt-got...
    • weihnachtsmarkt-grossduengen.de weihnachtsmarkt-gro...
    • weihnachtsmarkt-halle.de weihnachtsmarkt-hal...
    • weihnachtsmarkt-herford.de weihnachtsmarkt-her...
    • weihnachtsmarkt-hochstadt.de weihnachtsmarkt-hoc...
    • weihnachtsmarkt-illingen.de weihnachtsmarkt-ill...
    • weihnachtsmarkt-kirrweiler.de weihnachtsmarkt-kir...
    • weihnachtsmarkt-koblenz.de weihnachtsmarkt-kob...
    • weihnachtsmarkt-kueckhoven.de weihnachtsmarkt-kue...
    • weihnachtsmarkt-mellendorf.de weihnachtsmarkt-mel...
    • weihnachtsmarkt-michelau.de weihnachtsmarkt-mic...
    • weihnachtsmarkt-monschau.de weihnachtsmarkt-mon...
    • weihnachtsmarkt-neu-ulm.de weihnachtsmarkt-neu...
    • weihnachtsmarkt-neumuehl.de weihnachtsmarkt-neu...
    • weihnachtsmarkt-neunkirchen.de weihnachtsmarkt-neu...
    • weihnachtsmarkt-noerdlingen.de weihnachtsmarkt-noe...
    • weihnachtsmarkt-nordwalde.de weihnachtsmarkt-nor...
    • weihnachtsmarkt-ostercappeln.de weihnachtsmarkt-ost...
    • weihnachtsmarkt-osterstrasse.de weihnachtsmarkt-ost...
    • weihnachtsmarkt-pauluskirche.de weihnachtsmarkt-pau...
    • weihnachtsmarkt-pfennigparade.de weihnachtsmarkt-pfe...
    • weihnachtsmarkt-remmighausen.de weihnachtsmarkt-rem...
    • weihnachtsmarkt-schmalkalden.de weihnachtsmarkt-sch...
    • weihnachtsmarkt-schulze-beikel.de weihnachtsmarkt-sch...
    • weihnachtsmarkt-singen.de weihnachtsmarkt-sin...
    • weihnachtsmarkt-sophienstrasse.de weihnachtsmarkt-sop...
    • weihnachtsmarkt-steinau.de weihnachtsmarkt-ste...
    • weihnachtsmarkt-stralsund.de weihnachtsmarkt-str...
    • weihnachtsmarkt-trier.de weihnachtsmarkt-tri...
    • weihnachtsmarkt-trittau.de weihnachtsmarkt-tri...
    • weihnachtsmarkt-udenhain.de weihnachtsmarkt-ude...
    • weihnachtsmarkt-unna.de weihnachtsmarkt-unn...
    • weihnachtsmarkt-unterhausen.de weihnachtsmarkt-unt...
    • weihnachtsmarkt-wds.de weihnachtsmarkt-wds...
    • weihnachtsmarkt-weil-der-stadt.de weihnachtsmarkt-wei...
    • weihnachtsmarkt-wf.de weihnachtsmarkt-wf....
    • weihnachtsmarkt-wielen.de weihnachtsmarkt-wie...
    • weihnachtsmarkt-winterfeldtplatz.de weihnachtsmarkt-win...
    • weihnachtsmarkt-wolfenbuettel.de weihnachtsmarkt-wol...
    • weihnachtsmarkt-zechenwerkstatt.de weihnachtsmarkt-zec...
    • weihnachtsmarkt-zwickau.de weihnachtsmarkt-zwi...
    • weihnachtsmarkt.de weihnachtsmarkt.de
    • weihnachtsmarktbaeckerei.de weihnachtsmarktbaec...
    • weihnachtsmarktdortmund.de weihnachtsmarktdort...
  • Account
    • Register
  • Contact
  • Changelog

Vulnerabilities All vulnerable systems on domain: weihnachtsmarkt-dresden-neumarkt.de

  1. Active Domains
  2. favicon weihnachtsmarkt-dresden-neumarkt.de
  3. Vulnerabilities
  • Dashboard
  • 4 IPs
  • 0 0 0 IPs vulnerabilities
  • 3 Vhosts
  • 0 0 0 Vhosts vulnerabilities
  • 0 Breaches
  • Darknet
  • Networks
  • Organizations
  • ISPs
  • Worldmap
Cyberscan security assessment
0 vulnerabilities rated CRITICAL
0 vulnerabilities rated HIGH

Score

7.8
Accumulated CVSS Score The figure to the left is the accumulated score of all vulnerabilities detected for this view.
For more information see: First Org CVSS Specification
Your next step to view your scan results Please register and confirm your mail address.
Register
Critical Vulnerabilities 0 Critical Vulnerabilities
0%
High Vulnerabilities 0 High Vulnerabilities
0%
Medium Vulnerabilities 0 Medium Vulnerabilities
0%
Low Vulnerabilities 3 Low Vulnerabilities
100%
Step 1: Register
Click to register:
Open registration form
Step 2: Confirm email-address
1. Find our registration mail in your inbox.
2. Click the activation link.
3. Reload this page by clicking here.
Step 3: Request your personal offer
To see the full results you need to order a package. You can do so by clicking here.
Step 4: Verify the domain
To see the full results you need to verify the domain.

Scan new domain

Vul ID IP Port CVE CVSS Risk Family Name Summary First Seen Last Seen QoD Comment
Vul ID IP Port CVE CVSS Risk Family Name Summary First Seen Last Seen QoD Comment

More information?


To see more detailed information you need to register and add a package to your account.

Register a new membership

Salutation
cyberscan.io (Release 202304)
data privacy policy | general terms and conditions | revocational instruction | imprint | cookies | DGC AG